GET /api/protein/UniProt/B5R1P1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5R1P1",
"id": "RIHC_SALEP",
"source_organism": {
"taxId": "550537",
"scientificName": "Salmonella enteritidis PT4 (strain P125109)",
"fullName": "Salmonella enteritidis PT4 (strain P125109)"
},
"name": "Non-specific ribonucleoside hydrolase RihC",
"description": [
"Hydrolyzes both purine and pyrimidine ribonucleosides with a broad-substrate specificity"
],
"length": 306,
"sequence": "MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSVEKTTRNALQLLHFWDADVPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKPAFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNFTPNAEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHSLFNHYRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGEYTAGTTVVDIEGRLGQPANAQVALALDVDGFRQWVAEVFAYAP",
"proteome": null,
"gene": "rihC",
"go_terms": [
{
"identifier": "GO:0016799",
"name": "hydrolase activity, hydrolyzing N-glycosyl compounds",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016798",
"name": "hydrolase activity, acting on glycosyl bonds",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1866e7a69b17f2ae828b9d92f95387c3a7990a20",
"counters": {
"domain_architectures": 35706,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 35706
}
}
}