GET /api/protein/UniProt/B5R0R4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5R0R4",
        "id": "ULAE_SALEP",
        "source_organism": {
            "taxId": "550537",
            "scientificName": "Salmonella enteritidis PT4 (strain P125109)",
            "fullName": "Salmonella enteritidis PT4 (strain P125109)"
        },
        "name": "L-ribulose-5-phosphate 3-epimerase UlaE",
        "description": [
            "Catalyzes the isomerization of L-xylulose-5-phosphate to L-ribulose-5-phosphate. Is involved in the anaerobic L-ascorbate utilization"
        ],
        "length": 284,
        "sequence": "MLSKQIPLGIYEKALPAGECWLERLRLAKTLGFDFVEMSVDETDARLARLDWSREQRLALVSAVAETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQQANDETRCRFRDGLKESVDMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAENPAAEVAKARDWVKARMASAGLVEAA",
        "proteome": null,
        "gene": "ulaE",
        "go_terms": [
            {
                "identifier": "GO:0034015",
                "name": "L-ribulose-5-phosphate 3-epimerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016861",
                "name": "intramolecular oxidoreductase activity, interconverting aldoses and ketoses",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9badb73c803b7c97e5585dfc6efda42c6ecc2524",
        "counters": {
            "domain_architectures": 138699,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 3,
                "hamap": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 138699
        }
    }
}