GET /api/protein/UniProt/B5R0R4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5R0R4",
"id": "ULAE_SALEP",
"source_organism": {
"taxId": "550537",
"scientificName": "Salmonella enteritidis PT4 (strain P125109)",
"fullName": "Salmonella enteritidis PT4 (strain P125109)"
},
"name": "L-ribulose-5-phosphate 3-epimerase UlaE",
"description": [
"Catalyzes the isomerization of L-xylulose-5-phosphate to L-ribulose-5-phosphate. Is involved in the anaerobic L-ascorbate utilization"
],
"length": 284,
"sequence": "MLSKQIPLGIYEKALPAGECWLERLRLAKTLGFDFVEMSVDETDARLARLDWSREQRLALVSAVAETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQQANDETRCRFRDGLKESVDMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAENPAAEVAKARDWVKARMASAGLVEAA",
"proteome": null,
"gene": "ulaE",
"go_terms": [
{
"identifier": "GO:0034015",
"name": "L-ribulose-5-phosphate 3-epimerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016861",
"name": "intramolecular oxidoreductase activity, interconverting aldoses and ketoses",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9badb73c803b7c97e5585dfc6efda42c6ecc2524",
"counters": {
"domain_architectures": 138699,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 3,
"hamap": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 138699
}
}
}