GET /api/protein/UniProt/B5G6H2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5G6H2",
        "id": "WAPA_TROCA",
        "source_organism": {
            "taxId": "100989",
            "scientificName": "Tropidechis carinatus",
            "fullName": "Tropidechis carinatus (Australian rough-scaled snake)"
        },
        "name": "Carwaprin-a",
        "description": [
            "Damages membranes of susceptible bacteria. Has no hemolytic activity. Not toxic to mice. Does not inhibit the proteinases elastase and cathepsin G"
        ],
        "length": 75,
        "sequence": "MSSGGLLLLLGLLTLWAELTPISGQDRPKKPGLCPPRPQKPPCVRECKNDWRCPGEQKCCRYGCIYECRDPIFVK",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0030414",
                "name": "peptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0c9599f6bedc349a976a5fcc6a910fc509e98930",
        "counters": {
            "domain_architectures": 4938,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4938
        }
    }
}