HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5FY77",
"id": "B5FY77_TAEGU",
"source_organism": {
"taxId": "59729",
"scientificName": "Taeniopygia guttata",
"fullName": "Taeniopygia guttata (Zebra finch)"
},
"name": "Putative Di-Ras2 variant 1",
"description": [
"Displays low GTPase activity and exists predominantly in the GTP-bound form"
],
"length": 198,
"sequence": "MPEQSNDYRVVVFGAAGVGKSSLVLRFVRGTFRETYIPTIEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSVTSRQSMEDLHPIFDEICQIKGDIQKIPIMLVGNKSDDTQRELDASEGQALASKWKCAFMETSAKMNYNVQELFQELLNLEQRRTISLQVDGKKSNPQKKKDKLQGKCSVM",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
"counters": {
"domain_architectures": 273930,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 3,
"cathgene3d": 1,
"smart": 3,
"ncbifam": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 273930
}
}
}