GET /api/protein/UniProt/B5FTU1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5FTU1",
        "id": "CYSH_SALDC",
        "source_organism": {
            "taxId": "439851",
            "scientificName": "Salmonella dublin (strain CT_02021853)",
            "fullName": "Salmonella dublin (strain CT_02021853)"
        },
        "name": "Phosphoadenosine 5'-phosphosulfate reductase",
        "description": [
            "Catalyzes the formation of sulfite from phosphoadenosine 5'-phosphosulfate (PAPS) using thioredoxin as an electron donor"
        ],
        "length": 244,
        "sequence": "MSKLDLNALNELPKVDRVLALAETNAQLETLTAEERVAWALENLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDKLKLNLKVYRAGESPAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALKELKAQTWFAGLRREQSGSRAHLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG",
        "proteome": null,
        "gene": "cysH",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004604",
                "name": "phosphoadenylyl-sulfate reductase (thioredoxin) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019379",
                "name": "sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7eeef8759c43c36f2f8a365b1ed067ea1b563441",
        "counters": {
            "domain_architectures": 44311,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 3,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 44311
        }
    }
}