General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5FLE5",
        "id": "DLGD_SALDC",
        "source_organism": {
            "taxId": "439851",
            "scientificName": "Salmonella dublin (strain CT_02021853)",
            "fullName": "Salmonella dublin (strain CT_02021853)"
        },
        "name": "2,3-diketo-L-gulonate reductase",
        "description": [
            "Catalyzes the reduction of 2,3-diketo-L-gulonate in the presence of NADH, to form 3-keto-L-gulonate"
        ],
        "length": 332,
        "sequence": "MKVTFEELKGAFYRVLRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQQLDNGDIIPDAKPQRVTSLGAIEQWDAQRAIGNLTAKKMMDRAIELASDHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRELPVDGGFDDNGQLTKEPGVIEKNRRILPMGYWKGSGLSIVLDMIATLLSNGSSVAEVTQENSDEYGVSQIFIAIEVDKLIDGATRDAKLQRIMDFITTAERADDNVAIRLPGHEFTKLLDDNRRHGITIDDSVWAKIQAL",
        "proteome": null,
        "gene": "dlgD",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0047559",
                "name": "3-dehydro-L-gulonate 2-dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070403",
                "name": "NAD+ binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "816bed1e83cb37f0e42356ab02309c9da48e58a0",
        "counters": {
            "domain_architectures": 18615,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 18615
        }
    }
}