GET /api/protein/UniProt/B5F5J2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5F5J2",
        "id": "B5F5J2_SALA4",
        "source_organism": {
            "taxId": "454166",
            "scientificName": "Salmonella agona (strain SL483)",
            "fullName": "Salmonella agona (strain SL483)"
        },
        "name": "Small-conductance mechanosensitive channel",
        "description": [
            "Mechanosensitive channel that participates in the regulation of osmotic pressure changes within the cell, opening in response to stretch forces in the membrane lipid bilayer, without the need for other proteins. Contributes to normal resistance to hypoosmotic shock. Forms an ion channel of 1.0 nanosiemens conductance with a slight preference for anions. The channel is sensitive to voltage; as the membrane is depolarized, less tension is required to open the channel and vice versa. The channel is characterized by short bursts of activity that last for a few seconds"
        ],
        "length": 286,
        "sequence": "MEDLNVVDSINGAGTWLVRNQALLLSYAVNIVAAIAIIIIGLIVARVISNTVNRLMRARHIDATVADFLSALVRYGVIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLNVQIFSTTMRAVDGKIIVIPNGKIIAGNIINYSREPVRRNEFIIGVAYDSDIDQVKQLLTTIIESDDRILKDREMTVRLNELGASSINFVVRVWSKSSDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKDNAAE",
        "proteome": null,
        "gene": "SeAg_B3229",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008381",
                "name": "mechanosensitive monoatomic ion channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e269a7bc447a63f49cb692981ae7ac85629ff7f4",
        "counters": {
            "domain_architectures": 5888,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 4,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 10
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5888
        }
    }
}