HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5E7F2",
"id": "SYS_STRP4",
"source_organism": {
"taxId": "512566",
"scientificName": "Streptococcus pneumoniae serotype 19F (strain G54)",
"fullName": "Streptococcus pneumoniae serotype 19F (strain G54)"
},
"name": "Serine--tRNA ligase",
"description": [
"Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec)"
],
"length": 424,
"sequence": "MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILIKVETLKAERNTVSAEIAQAKRNKENTDDKIAAMQNLSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGADXXXNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPLTNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVVALSTGDMGFSATKTYDLEVWIPAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPYMGGAEVIKP",
"proteome": null,
"gene": "serS",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004828",
"name": "serine-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006434",
"name": "seryl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "abd0a67fe18a7ecd4ebd3536c1b1a039805449ac",
"counters": {
"domain_architectures": 33871,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 2,
"cdd": 1,
"profile": 1,
"ncbifam": 1,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 33871
}
}
}