General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5E5F8",
        "id": "MECA_STRP4",
        "source_organism": {
            "taxId": "512566",
            "scientificName": "Streptococcus pneumoniae serotype 19F (strain G54)",
            "fullName": "Streptococcus pneumoniae serotype 19F (strain G54)"
        },
        "name": "Adapter protein MecA",
        "description": [
            "Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis"
        ],
        "length": 245,
        "sequence": "MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDKVDVFVTKSKIDQNLDFEDLSDLPDMEELAQMSPDEFIKTLEKSIADKTKDDIEAIQSLEQVEAKEEEQEQAEQEAESKKEPYIYYILSFAKLADLVVFAKTVTFEMETSELYKMNERYYLTILVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVLNLQKIG",
        "proteome": null,
        "gene": "mecA",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b3cf1b2f486caf43617c4d807ff05db34e836ea4",
        "counters": {
            "domain_architectures": 4605,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4605
        }
    }
}