HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5CW16",
"id": "B5CW16_PHOPM",
"source_organism": {
"taxId": "484018",
"scientificName": "Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / CCUG 54634 / M2)",
"fullName": "Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / CCUG 54634 / M2)"
},
"name": "Octanoyltransferase",
"description": [
"Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate"
],
"length": 221,
"sequence": "MITIENWGLISYSEAWERQTALFDELIDAKLNGKPYTNRIIFCQHPHVYTLGKHGKAANMLLNPTQLQTIHAELFQVDRGGDITYHGPGQWVCYPILNLEDFHLGLKEYLHLLEEAVIRVCRTYGIETDRVHGATGVWLATGTPEERKICAMGVRSSHFVTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLQAELRQEVPMDEVRDRLEQLILELLKETA",
"proteome": null,
"gene": "lipB",
"go_terms": [
{
"identifier": "GO:0033819",
"name": "lipoyl(octanoyl) transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009249",
"name": "protein lipoylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0036211",
"name": "protein modification process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c31ed954e7a430bfa6effa7d5abb1606810f26b8",
"counters": {
"domain_architectures": 40137,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"hamap": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 40137
}
}
}