GET /api/protein/UniProt/B5CW16/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5CW16",
        "id": "B5CW16_PHOPM",
        "source_organism": {
            "taxId": "484018",
            "scientificName": "Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / CCUG 54634 / M2)",
            "fullName": "Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / CCUG 54634 / M2)"
        },
        "name": "Octanoyltransferase",
        "description": [
            "Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate"
        ],
        "length": 221,
        "sequence": "MITIENWGLISYSEAWERQTALFDELIDAKLNGKPYTNRIIFCQHPHVYTLGKHGKAANMLLNPTQLQTIHAELFQVDRGGDITYHGPGQWVCYPILNLEDFHLGLKEYLHLLEEAVIRVCRTYGIETDRVHGATGVWLATGTPEERKICAMGVRSSHFVTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLQAELRQEVPMDEVRDRLEQLILELLKETA",
        "proteome": null,
        "gene": "lipB",
        "go_terms": [
            {
                "identifier": "GO:0033819",
                "name": "lipoyl(octanoyl) transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009249",
                "name": "protein lipoylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0036211",
                "name": "protein modification process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c31ed954e7a430bfa6effa7d5abb1606810f26b8",
        "counters": {
            "domain_architectures": 40137,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 40137
        }
    }
}