General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5BCP2",
        "id": "ARNF_SALPK",
        "source_organism": {
            "taxId": "554290",
            "scientificName": "Salmonella paratyphi A (strain AKU_12601)",
            "fullName": "Salmonella paratyphi A (strain AKU_12601)"
        },
        "name": "Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF",
        "description": [
            "Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane"
        ],
        "length": 125,
        "sequence": "MGVMWGLISVAIASLAQLSLGFAMMRLPSIAHPLAFISGLGAFNAATLALFAGLAGYLVSVFCWQKTLHMLALSKAYALLSLSYVLVWVASMLLPGLQGAFSLKAMLGVLCIMAGVMLIFLPARS",
        "proteome": null,
        "gene": "arnF",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:1901505",
                "name": "carbohydrate derivative transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009103",
                "name": "lipopolysaccharide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1
        }
    }
}