General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5A9T1",
        "id": "D2CYA_RANDY",
        "source_organism": {
            "taxId": "71582",
            "scientificName": "Rana dybowskii",
            "fullName": "Rana dybowskii (Dybovsky's frog)"
        },
        "name": "Dybowskin-2CDYa",
        "description": [
            "Antimicrobial peptide. Has activity against the Gram-positive bacterium S.aureus (MIC=6 uM) and the Gram-negative bacterium E.coli (MIC=3 uM). Lacks hemolytic activity against human erythrocytes"
        ],
        "length": 65,
        "sequence": "MFTLKKSLLLLFFIGVIKLSLCEEERNADDDERRDDPDEMDVEVENRSAVGRHGRRFGLRKHRKH",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "86efce3322e7540ca9b6185593e880636cc42adb",
        "counters": {
            "domain_architectures": 1232,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1232
        }
    }
}