GET /api/protein/UniProt/B4ZAF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4ZAF4",
"id": "B4ZAF4_BATSE",
"source_organism": {
"taxId": "382305",
"scientificName": "Batrachostomus septimus",
"fullName": "Batrachostomus septimus (Philippine frogmouth)"
},
"name": "Elongation factor 2",
"description": [
"Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome"
],
"length": 187,
"sequence": "FAAKGDAQLNPTERAKKVEDMMKKLWGDRYFDPATGKFSKSATSPDGKKLPRTFCQLIXXXXXXVFNAIMNFKKEEAAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAIGIKNCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVS",
"proteome": null,
"gene": "EEF2",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1
}
}
}