General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4Z977",
        "id": "B4Z977_ANTCN",
        "source_organism": {
            "taxId": "1977160",
            "scientificName": "Antigone canadensis",
            "fullName": "Antigone canadensis (Sandhill crane)"
        },
        "name": "Clathrin heavy chain linker core motif domain-containing protein",
        "description": null,
        "length": 108,
        "sequence": "GIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGIL",
        "proteome": null,
        "gene": "CLTC",
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030130",
                "name": "clathrin coat of trans-Golgi network vesicle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030132",
                "name": "clathrin coat of coated pit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c01d58b1d9367d201bd3c0635c47c438dbc6dee",
        "counters": {
            "domain_architectures": 237,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 237
        }
    }
}