HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4Y3C2",
"id": "B4Y3C2_9TELE",
"source_organism": {
"taxId": "69231",
"scientificName": "Poecilia parae",
"fullName": "Poecilia parae"
},
"name": "G-protein coupled receptors family 1 profile domain-containing protein",
"description": [
"Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal"
],
"length": 356,
"sequence": "MAEEWGKQVFAARRHEDTTRGSAFTYTNSNHTKDPFEGPNYHIAPRWVYNLSTLWMCIVVVLSVFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETVFASTISVCXQFFGYFILGHPMCVFEGFTVSTCGIAALWSLTIISWERWVVVCKXLGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRFWPHGLKTSCGPDVFSGSDDPGVLSYMIVLMITCCFIPLAIIILCYLAVWLAIRAVAMQQKESESTQKAEREVSRMVVVMIVAYCVCWGPYTFFACFAAANPGYAFHPLAAAMPAYFAKSATIYNPIIYVFMNRQFRTCIMQLFGKQVDDGSEVSTSKTEVSSVAPA",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0007601",
"name": "visual perception",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007602",
"name": "phototransduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "5040ebb238de8327affa8e634607f69b286b63d6",
"counters": {
"domain_architectures": 11561,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prosite": 2,
"prints": 3,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 11561
}
}
}