GET /api/protein/UniProt/B4USU8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4USU8",
        "id": "B4USU8_OTOGA",
        "source_organism": {
            "taxId": "30611",
            "scientificName": "Otolemur garnettii",
            "fullName": "Otolemur garnettii (Small-eared galago)"
        },
        "name": "ADP-ribosylation factor",
        "description": [
            "GTP-binding protein involved in protein trafficking; modulates vesicle budding and uncoating within the Golgi apparatus"
        ],
        "length": 180,
        "sequence": "MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR",
        "proteome": "UP000005225",
        "gene": "ARF5",
        "go_terms": [
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d6bc1331c4b416e231f52943c4822a3a2b702855",
        "counters": {
            "domain_architectures": 72767,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 3,
                "pfam": 1,
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "ncbifam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 72767
        }
    }
}