HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4RE11",
"id": "FOLD_PHEZH",
"source_organism": {
"taxId": "450851",
"scientificName": "Phenylobacterium zucineum (strain HLK1)",
"fullName": "Phenylobacterium zucineum (strain HLK1)"
},
"name": "Bifunctional protein FolD",
"description": [
"Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate"
],
"length": 297,
"sequence": "MTAKIIDGKVLAERLRGQVADEVARLRADYRLQPGLAVVLVGEDPASQVYVRSKGEHSLAVGMHSVTHRLPADTRQDELLRLVAELNADPLIHGILVQLPLPKHLDEKAVIAAISPDKDVDGLHVVNAGRLASGLPALVPCTPLGCLIMLRETLGDLTGKRAVVVGRSLLVGKPVAQLLLQADCTVTIAHSRTVDLPAVCREADILVAAVGRPRMIRGDWIKPGATVIDVGINRVPFDDPEKAAQGKTKLVGDVHYKEALQVAGAVTPVPGGVGLMTVACLLQNTVTAAKRLAGIEG",
"proteome": "UP000001868",
"gene": "folD",
"go_terms": [
{
"identifier": "GO:0004488",
"name": "methylenetetrahydrofolate dehydrogenase (NADP+) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "23f8e7ee0e8caf68810771f795143dc480826ffa",
"counters": {
"domain_architectures": 36777,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"pfam": 2,
"cathgene3d": 2,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"prosite": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 36777
}
}
}