General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4R947",
        "id": "CLPS_PHEZH",
        "source_organism": {
            "taxId": "450851",
            "scientificName": "Phenylobacterium zucineum (strain HLK1)",
            "fullName": "Phenylobacterium zucineum (strain HLK1)"
        },
        "name": "ATP-dependent Clp protease adapter protein ClpS",
        "description": [
            "Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation"
        ],
        "length": 109,
        "sequence": "MSERKEGDSGAGVRSAVITQTKPKTQKPAMYRVLLLNDDYTPMEFVVYVLEQFFNKSREDATRIMLHVHQHGVGVCGVYTYEVAETKVAQVVDTARRHQHPLQCTMEKD",
        "proteome": "UP000001868",
        "gene": "clpS",
        "go_terms": [
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d52f623440b9fe9a889148966c03893a09b55845",
        "counters": {
            "domain_architectures": 19190,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19190
        }
    }
}