HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4NXA4",
"id": "B4NXA4_DROYA",
"source_organism": {
"taxId": "7245",
"scientificName": "Drosophila yakuba",
"fullName": "Drosophila yakuba (Fruit fly)"
},
"name": "1-Cys peroxiredoxin",
"description": [
"Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides"
],
"length": 222,
"sequence": "MSGKALNIGDQFPNFTADTSVGQIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALVPEFQKRGVKPIALSCDTVASHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAVFVVDEKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDIPKLFPDGIETIEVPSGKSYLRITPQP",
"proteome": "UP000002282",
"gene": "Dyak\\GE14982",
"go_terms": [
{
"identifier": "GO:0016209",
"name": "antioxidant activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051920",
"name": "peroxiredoxin activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0098869",
"name": "cellular oxidant detoxification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9db26b9b236ea914ef8a2d52a7760b3ae17fb31b",
"counters": {
"domain_architectures": 37286,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 1,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 37286
}
}
}