GET /api/protein/UniProt/B4NBS6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4NBS6",
        "id": "B4NBS6_DROWI",
        "source_organism": {
            "taxId": "7260",
            "scientificName": "Drosophila willistoni",
            "fullName": "Drosophila willistoni (Fruit fly)"
        },
        "name": "Large ribosomal subunit protein uL30",
        "description": [
            "Binds to G-rich structures in 28S rRNA and in mRNAs. Plays a regulatory role in the translation apparatus; inhibits cell-free translation of mRNAs"
        ],
        "length": 252,
        "sequence": "MPAPVAKKPAAKKLPAVPESKLKFSKKVVSKRAAETKRRLKRAAVIALRKKENLVRAEKYQNEYIKADQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATVNMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQLQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDKINRLLRKMV",
        "proteome": "UP000007798",
        "gene": "Dwil\\GK18655",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c584cdf392ce24e9ea441bf0e77e57c08b1dd726",
        "counters": {
            "domain_architectures": 7561,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7561
        }
    }
}