GET /api/protein/UniProt/B4LKL0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4LKL0",
        "id": "B4LKL0_DROVI",
        "source_organism": {
            "taxId": "7244",
            "scientificName": "Drosophila virilis",
            "fullName": "Drosophila virilis (Fruit fly)"
        },
        "name": "Cytosol aminopeptidase",
        "description": [
            "Cytosolic metallopeptidase that catalyzes the removal of unsubstituted N-terminal hydrophobic amino acids from various peptides. The presence of Zn(2+) ions is essential for the peptidase activity, and the association with other cofactors can modulate the substrate spectificity of the enzyme. For instance, in the presence of Mn(2+), it displays a specific Cys-Gly hydrolyzing activity of Cys-Gly-S-conjugates. Involved in the metabolism of glutathione and in the degradation of glutathione S-conjugates, which may play a role in the control of the cell redox status"
        ],
        "length": 523,
        "sequence": "MKHMNRNTIRSFLSLRSVARLINVRYACETSTVGGKGVVVGIYLKEGDKDPKFTPSGEKLNDRTSGKLRQLICETKVDGRLGRGRVFNNIDPDFSSVAVVGVGIEGIGFNELEMLDEGMENVRVAAGVGARSLQEQGCHTIAVDGMDYAEQAAEGSSLAVWRFSDNMNKKNRLITPRLELYDSADMDGWTRGIFKAESQNLARRLSDAPANCMTPTMFAQATVDALCPCGITVEVRTMDWIEMQRMHAFLMIAKGSCEPPVLLEISYCGTAPEDKPILFVGKGITFNSGGINLRPCKGMDEYRGSMSAAAAIIGMMRCIAALSLPINVTCVIPLCENMPSGMSVKPGDVVTMLNARSMAIRDVDKAGVVVMADPLIYGQTTYKPRLVVDVAALGMGVKKAYGGGASGIFSNSHYVWKQFQRAGSLTGDRLWRMPLWQYYKKQVSDETGYDLSNDGRGNASSCLAAAILHELVPCADWAHIDTRGTGLLTKFGLVPYLTARYMTGRPTRTLVQFVYQMACPEIK",
        "proteome": "UP000008792",
        "gene": "Dvir\\GJ20697",
        "go_terms": [
            {
                "identifier": "GO:0070006",
                "name": "metalloaminopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030145",
                "name": "manganese ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019538",
                "name": "protein metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5e69a2aa28cd056abaf8be0fdbafffbba4d7d13d",
        "counters": {
            "domain_architectures": 22296,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22296
        }
    }
}