General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4IK33",
        "id": "ENY2_DROSE",
        "source_organism": {
            "taxId": "7238",
            "scientificName": "Drosophila sechellia",
            "fullName": "Drosophila sechellia (Fruit fly)"
        },
        "name": "Enhancer of yellow 2 transcription factor",
        "description": [
            "Involved in mRNA export coupled transcription activation by association with both the AMEX and the SAGA complexes. The SAGA complex is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Involved in transcription elongation by recruiting the THO complex onto nascent mRNA. The AMEX complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). AMEX participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity)"
        ],
        "length": 101,
        "sequence": "MSISSAVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILIEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRTILTEIEEEADEPEDES",
        "proteome": "UP000001292",
        "gene": "e(y)2",
        "go_terms": [
            {
                "identifier": "GO:0003713",
                "name": "transcription coactivator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006406",
                "name": "mRNA export from nucleus",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045893",
                "name": "positive regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000124",
                "name": "SAGA complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba9455d725df3ff238858c99315bda05780bc904",
        "counters": {
            "domain_architectures": 3443,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3443
        }
    }
}