General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4HPY6",
        "id": "B4HPY6_DROSE",
        "source_organism": {
            "taxId": "7238",
            "scientificName": "Drosophila sechellia",
            "fullName": "Drosophila sechellia (Fruit fly)"
        },
        "name": "Defective in cullin neddylation protein",
        "description": [
            "Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity",
            "Promotes neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes and thus regulates SCF-type complex activity. Function promotes cell proliferation"
        ],
        "length": 334,
        "sequence": "MGNCLKCFQSAAEQSMPTNASSPNSHNSNSNACQTATSLANCYESVGINPNANERCALETDELLSSRTPLKPAKANNCDTKRNSFKSLGLLNGSAPTMSDIITTAVKESMEVSHQTLSKLFDEYKDPDDEEMILTDGIERLCNDLNYQPDEFAILVLAWCLDASQMCRFTKVEFIEGLHKMRADTIASIRVRLEQTIEMLKADAEMFKQLYRFTFRFGLEPDQRVLSLEMAIDLWKLVFTVQTPDLFSNWIHFLEKHPNIRRIPKDTWNMYLNFTEQCDIQNYDDTEAWPSLFDDFVDYEKSRALVSSGIHDDDNNNDDPLQSHVKAEDPGLVS",
        "proteome": "UP000001292",
        "gene": "Dsec\\GM20324",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aa9b7783716604b54160d7347c630aebb2e0f5d9",
        "counters": {
            "domain_architectures": 8047,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8047
        }
    }
}