GET /api/protein/UniProt/B4G256/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4G256",
"id": "B4G256_MAIZE",
"source_organism": {
"taxId": "4577",
"scientificName": "Zea mays",
"fullName": "Zea mays (Maize)"
},
"name": "Dirigent protein",
"description": [
"Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism"
],
"length": 315,
"sequence": "MAKLQVTPGAAFTECNELNFQGLYMYHTPLGPKANQAAILESKAKIGIGATVVNNWAVYDGPGPGAKLVGRAQGLHILAGNWVNSFTLVFEDERFSGSTLEVRGITVETGEWAVVGGTGQFAMANGIISKKLHEQRSDGNVIELSVHAFCPLLKGKRGGAVTKVGPWGGSGGSPMELTETETPMRLESITVSSGVAVNSISFSYVDSAGHKRSAGPWGGSGGQPDQVQLAESEVVTQVSGTYGTIDDDDRTVITSIKFVTNLDKTYGPFGAYGDGDDTSFTVPVQPGSGAIVGFFARVGGAGDYLDAIGVYVRPL",
"proteome": "UP000007305",
"gene": "LOC103164609",
"go_terms": [
{
"identifier": "GO:0030246",
"name": "carbohydrate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7e3ffa7225689d1a4d9be4e9dcf7c3184902c1e7",
"counters": {
"domain_architectures": 523,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"profile": 1,
"pfam": 2,
"smart": 1,
"cdd": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 523
}
}
}