GET /api/protein/UniProt/B4F756/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4F756",
        "id": "B4F756_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "Cysteine protease",
        "description": [
            "Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins"
        ],
        "length": 442,
        "sequence": "RIPDPSNLGPSGSGVAALGSTGTDPAEPDEVDKFKTKFLTAWNNVKYGWAVKSRTSFSKISSVHLCGRCYHFEGEGDIQRFQRDFVSRLWLTYRRDFPPLAGSLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWRWVEGTGLASSEMPGPASPSRYRGPGRRGPLRCAQGALEMEPDRWHRRIVSWFADHPQAPFGLHRLVELGQSSGKKAGDWYGPSVVAHILRKAVESCSEVTRLVVYVSQDCTVYKADVARLVSWPDPTAEWKSVVILVPVRLGGETLNPVYVPCVKELLRSELCLGIMGGKPRHSLYFIGYQDDFLLYLDPHYCQPTVDVNQANFPLESFHCTSPRKMAFAKMDPSCTVGFYAGNRKEFETLCSELMRILSSSSVTERYPMFTVAEGHAQDHSLDALCTQLSQPTLRLPCTGRLLKAKRPSSEDFVFL",
        "proteome": null,
        "gene": "Atg4d",
        "go_terms": [
            {
                "identifier": "GO:0008234",
                "name": "cysteine-type peptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019786",
                "name": "protein-phosphatidylethanolamide deconjugating activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6d3a3c7a42f0bbe649d79e43e20fc010e35776db",
        "counters": {
            "domain_architectures": 8470,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8470
        }
    }
}