General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B3R2B4",
        "id": "RRF_CUPTR",
        "source_organism": {
            "taxId": "977880",
            "scientificName": "Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)",
            "fullName": "Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)"
        },
        "name": "Ribosome-recycling factor",
        "description": [
            "Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another"
        ],
        "length": 186,
        "sequence": "MSVADTKKSAEQKMQKSIEAFKADLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVAAIGLADARTITVQPWEKKMVSAVEKAIRDCDLGLNPATMGEVIRVPMPALTEERRKELTKVVKGEAEGAKVAVRNLRRDANEQFKKLVKDKTISEDEERRGQDEVQKLTDKYVAEIDRMVAEKEKEIMTV",
        "proteome": "UP000001692",
        "gene": "frr",
        "go_terms": [
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2d958ca5738752922f7c19b7aa2806b876ecf5c1",
        "counters": {
            "domain_architectures": 30231,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30231
        }
    }
}