GET /api/protein/UniProt/B3NRP1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B3NRP1",
"id": "FBSP1_DROER",
"source_organism": {
"taxId": "7220",
"scientificName": "Drosophila erecta",
"fullName": "Drosophila erecta (Fruit fly)"
},
"name": "F-box/SPRY domain-containing protein 1",
"description": [
"Required in the presynaptic motoneuron to down-regulate the levels of wnd and restrain synaptic terminal growth at the neuromuscular junction (NMJ)"
],
"length": 255,
"sequence": "MVDPVAALCNYNVLEVIFSYLELEDLSHCSQVCKSWYHFLNDENSDVWRWHCLNKLPKEALKSDLLSSVSTYKTKLRAYFHAWSPNDCSRNVYIKPNGFTLHRNPVAQSTDAARGKIGFRHGRHTWEVIWEGPLGTVAVIGISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYLGTPLDG",
"proteome": "UP000008711",
"gene": "Fsn",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e4d29b25a7c18ae8ffda42e5c01db858a30454d5",
"counters": {
"domain_architectures": 1127,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 2,
"ssf": 2,
"pfam": 2,
"profile": 1,
"smart": 1,
"panther": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1127
}
}
}