GET /api/protein/UniProt/B3NRP1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B3NRP1",
        "id": "FBSP1_DROER",
        "source_organism": {
            "taxId": "7220",
            "scientificName": "Drosophila erecta",
            "fullName": "Drosophila erecta (Fruit fly)"
        },
        "name": "F-box/SPRY domain-containing protein 1",
        "description": [
            "Required in the presynaptic motoneuron to down-regulate the levels of wnd and restrain synaptic terminal growth at the neuromuscular junction (NMJ)"
        ],
        "length": 255,
        "sequence": "MVDPVAALCNYNVLEVIFSYLELEDLSHCSQVCKSWYHFLNDENSDVWRWHCLNKLPKEALKSDLLSSVSTYKTKLRAYFHAWSPNDCSRNVYIKPNGFTLHRNPVAQSTDAARGKIGFRHGRHTWEVIWEGPLGTVAVIGISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYLGTPLDG",
        "proteome": "UP000008711",
        "gene": "Fsn",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e4d29b25a7c18ae8ffda42e5c01db858a30454d5",
        "counters": {
            "domain_architectures": 1127,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "ssf": 2,
                "pfam": 2,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1127
        }
    }
}