General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B3GZZ2",
        "id": "NQRA_ACTP7",
        "source_organism": {
            "taxId": "537457",
            "scientificName": "Actinobacillus pleuropneumoniae serotype 7 (strain AP76)",
            "fullName": "Actinobacillus pleuropneumoniae serotype 7 (strain AP76)"
        },
        "name": "Na(+)-translocating NADH-quinone reductase subunit A",
        "description": [
            "NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol"
        ],
        "length": 449,
        "sequence": "MITIKKGLDLPIAGTPAQVIHNGNTVNEVAMLGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVVTINRGEKRVLQSVVIKVEGDEQITFTRYEAAQLASLSAEQVKQNLIESGLWTAFRTRPFSKVPALDAIPSSIFVNAMDTNPLAADPEVVLKEYETDFKDGLTVLTRLFNGQKPVYLCKDADSNIPLSPAIEGITIKSFSGVHPAGLVGTHIHFVDPVGATKQVWHLNYQDVIAIGKLFTTGELFTDRIISLAGPQVKNPRLVRTRLGANLSQLTANELNAGENRVISGSVLSGATAAGPVDYLGRYALQVSVLAEGREKELFGWIMPGSDKFSITRTVLGHFGKKLFNFTTAVHGGERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLRAALEKIEKEG",
        "proteome": null,
        "gene": "nqrA",
        "go_terms": [
            {
                "identifier": "GO:0016655",
                "name": "oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006814",
                "name": "sodium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aa851fd70d737084b30c89b85ea41ad3373fed2b",
        "counters": {
            "domain_architectures": 4437,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4437
        }
    }
}