GET /api/protein/UniProt/B3E455/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B3E455",
        "id": "B3E455_TRIL1",
        "source_organism": {
            "taxId": "398767",
            "scientificName": "Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)",
            "fullName": "Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)"
        },
        "name": "Prepilin leader peptidase/N-methyltransferase",
        "description": [
            "Plays an essential role in type IV pili and type II pseudopili formation by proteolytically removing the leader sequence from substrate proteins and subsequently monomethylating the alpha-amino group of the newly exposed N-terminal phenylalanine"
        ],
        "length": 258,
        "sequence": "MPPLMYLAVVVFLFGAVIGSFLNVCIYRLPLDQSIVSPGSRCMSCGAAVRWFDNVPIISWLLLRGRCRGCGAAFSIRYPLVELLTACLLLLLFLRFGLTVPFFIYSLLVAALIVVTFIDFDHQIIPDEISLPGVGLGFLASFFLPEPGWLSSLLGIVVGWGSLALVFYSYLWLTGREGMGGGDAKLLAMLGAFLGLKAVPFIIFTSSLVGTVAGLSIMALQRKGRHLAIPFGPYLALGAVLYIFYGPQLINWYLHLGK",
        "proteome": "UP000002420",
        "gene": "Glov_2160",
        "go_terms": [
            {
                "identifier": "GO:0004190",
                "name": "aspartic-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c44d9b7a0e0e7b804baabdf5506ebd1b277bda0f",
        "counters": {
            "domain_architectures": 12491,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12491
        }
    }
}