GET /api/protein/UniProt/B3E455/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B3E455",
"id": "B3E455_TRIL1",
"source_organism": {
"taxId": "398767",
"scientificName": "Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)",
"fullName": "Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)"
},
"name": "Prepilin leader peptidase/N-methyltransferase",
"description": [
"Plays an essential role in type IV pili and type II pseudopili formation by proteolytically removing the leader sequence from substrate proteins and subsequently monomethylating the alpha-amino group of the newly exposed N-terminal phenylalanine"
],
"length": 258,
"sequence": "MPPLMYLAVVVFLFGAVIGSFLNVCIYRLPLDQSIVSPGSRCMSCGAAVRWFDNVPIISWLLLRGRCRGCGAAFSIRYPLVELLTACLLLLLFLRFGLTVPFFIYSLLVAALIVVTFIDFDHQIIPDEISLPGVGLGFLASFFLPEPGWLSSLLGIVVGWGSLALVFYSYLWLTGREGMGGGDAKLLAMLGAFLGLKAVPFIIFTSSLVGTVAGLSIMALQRKGRHLAIPFGPYLALGAVLYIFYGPQLINWYLHLGK",
"proteome": "UP000002420",
"gene": "Glov_2160",
"go_terms": [
{
"identifier": "GO:0004190",
"name": "aspartic-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c44d9b7a0e0e7b804baabdf5506ebd1b277bda0f",
"counters": {
"domain_architectures": 12491,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12491
}
}
}