GET /api/protein/UniProt/B3DPY3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B3DPY3",
        "id": "CH10_BIFLD",
        "source_organism": {
            "taxId": "205913",
            "scientificName": "Bifidobacterium longum (strain DJO10A)",
            "fullName": "Bifidobacterium longum (strain DJO10A)"
        },
        "name": "Co-chaperonin GroES",
        "description": [
            "Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel"
        ],
        "length": 97,
        "sequence": "MSIKLTPLEDKIIVKQAEAQTQTASGLYIPDNAKEKPQQGEVLAVGPGRRDDKGERIPMDVKVGDKVLYSKYGGTEVHYEGEDYLIVGARDILAILG",
        "proteome": null,
        "gene": "groES",
        "go_terms": [
            {
                "identifier": "GO:0006457",
                "name": "protein folding",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0044183",
                "name": "protein folding chaperone",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96ac8ba8a540be879c6c062e6821e3878208f354",
        "counters": {
            "domain_architectures": 38603,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "smart": 1,
                "ncbifam": 4,
                "panther": 1,
                "hamap": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 38603
        }
    }
}