GET /api/protein/UniProt/B3DLL0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B3DLL0",
        "id": "B3DLL0_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Ran-binding protein 9",
        "description": [
            "May act as scaffolding protein, and as adapter protein to couple membrane receptors to intracellular signaling pathways. Acts as a mediator of cell spreading and actin cytoskeleton rearrangement. Core component of the CTLH E3 ubiquitin-protein ligase complex that mediates ubiquitination and subsequent proteasomal degradation of target proteins"
        ],
        "length": 548,
        "sequence": "MSSPPLHGLSSVGHLSRDPPPRSWSPRDKCSYLGLSHGNLRVHYKGHGKTSKDAASVRSTHPIPAACGIFYFEVKIISKGRDGYMGIGLSTQGVNLNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLIDNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQSPFVFDIEDYIREWRSKIQAQIERFPVGGEWQSMIQRMVSSYLVHHGYCSTAEAFAKSTDQTVQEELASIKNRQRIQKLVLSGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGNRSLKSLDGCSGSDSNCSNGIISNKAHQTHCHSKSQSSNLNVTELNSINMTMSHQFNSYSSNDVEMETDHYSNGFSASTSNGFLNGSSRHEPELEECDTEMEVDTSHGRRQLCGGSQAAVERMICFGRELQTMSEQLRRERGKNATNKNMLKDAFSLLAYSDPWNSPVGYQLDPIQREHVCSSLNSAILDIHNLPKQPPLSLALEQASQCLEMMAQCGIGSCAFARVADYLH",
        "proteome": "UP000186698",
        "gene": "ranbp9.S",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2a74386c914acb9a855a5d3264cd1c394fed8f3d",
        "counters": {
            "domain_architectures": 1881,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 4,
                "pfam": 3,
                "panther": 1,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1881
        }
    }
}