GET /api/protein/UniProt/B2UX54/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2UX54",
        "id": "SYS_CLOBA",
        "source_organism": {
            "taxId": "508767",
            "scientificName": "Clostridium botulinum (strain Alaska E43 / Type E3)",
            "fullName": "Clostridium botulinum (strain Alaska E43 / Type E3)"
        },
        "name": "Serine--tRNA ligase",
        "description": [
            "Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec)"
        ],
        "length": 425,
        "sequence": "MLDLKRIRNNPEEIKKLLSNRGEDFDVAVIDEIVTLDEERRKILVEVESLKGKRNQVSAEIPKLKKAGEDVTQIMNDMRKLGEEIKNFDTRVNEINERIEYIMLRIPNIPNPEVPDGETDEDNVEIKKWGEPTKFTFEPKAHWDLGTDLNILDFERGGKVAGSRFTVYKGLGARLERSIINYFLDKHTTENGYTEILPPYMVNRDSMTGTGQLPKFEEDAFKVENNGYFLIPTAEVPVTNMYRNEVLSGDILPIKHAAYSACFRAEAGSAGRDTRGLVRQHQFNKVELVKFCKPEDSYAELDKLVEDAESVLQGLGLPYRIVRICKGDLGFTAALKYDIEVWMPSYNRYVEISSCSNFEDFQARRANIKYRETPKDKPKFIHTLNGSGVAIGRTVAAVLENYQKEDGTVEIPEAIKRFMNVDFIK",
        "proteome": null,
        "gene": "serS",
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004812",
                "name": "aminoacyl-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006418",
                "name": "tRNA aminoacylation for protein translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004828",
                "name": "serine-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006434",
                "name": "seryl-tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "abd0a67fe18a7ecd4ebd3536c1b1a039805449ac",
        "counters": {
            "domain_architectures": 33871,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "cdd": 1,
                "profile": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33871
        }
    }
}