GET /api/protein/UniProt/B2U4P5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B2U4P5",
"id": "B2U4P5_SHIB3",
"source_organism": {
"taxId": "344609",
"scientificName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)",
"fullName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)"
},
"name": "DNA-binding protein HU-beta",
"description": [
"Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions"
],
"length": 90,
"sequence": "MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN",
"proteome": "UP000001030",
"gene": "hupB",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030527",
"name": "structural constituent of chromatin",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "69cfcabeafc3186618e3c95978399e9c6cf3360d",
"counters": {
"domain_architectures": 61377,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 61377
}
}
}