General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2U3Y5",
        "id": "IRAP_SHIB3",
        "source_organism": {
            "taxId": "344609",
            "scientificName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)",
            "fullName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)"
        },
        "name": "Anti-adapter protein IraP",
        "description": [
            "Inhibits RpoS proteolysis by regulating RssB activity, thereby increasing the stability of the sigma stress factor RpoS especially during phosphate starvation, but also in stationary phase and during nitrogen starvation. Its effect on RpoS stability is due to its interaction with RssB, which probably blocks the interaction of RssB with RpoS, and the consequent delivery of the RssB-RpoS complex to the ClpXP protein degradation pathway"
        ],
        "length": 86,
        "sequence": "MKNLIAELLLKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQQRLIEQVDGALYEVKPDASIPDDDTELLRNYVKKLLKHPRQ",
        "proteome": "UP000001030",
        "gene": "iraP",
        "go_terms": [
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6c78ed745bf088051cb613a746d73eb3dbb75525",
        "counters": {
            "domain_architectures": 1084,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1084
        }
    }
}