GET /api/protein/UniProt/B2TZI1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B2TZI1",
"id": "CYSC_SHIB3",
"source_organism": {
"taxId": "344609",
"scientificName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)",
"fullName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)"
},
"name": "Adenylyl-sulfate kinase",
"description": [
"Catalyzes the synthesis of activated sulfate"
],
"length": 201,
"sequence": "MALHDENVVWHSHPVTVQQRELHHCHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQLVTNLVQQLLDLLRQNDIIRS",
"proteome": "UP000001030",
"gene": "cysC",
"go_terms": [
{
"identifier": "GO:0004020",
"name": "adenylylsulfate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000103",
"name": "sulfate assimilation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1c59cf68b0cca9e4b38bd0f18061a8656471c2b7",
"counters": {
"domain_architectures": 14683,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14683
}
}
}