GET /api/protein/UniProt/B2TZI1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2TZI1",
        "id": "CYSC_SHIB3",
        "source_organism": {
            "taxId": "344609",
            "scientificName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)",
            "fullName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)"
        },
        "name": "Adenylyl-sulfate kinase",
        "description": [
            "Catalyzes the synthesis of activated sulfate"
        ],
        "length": 201,
        "sequence": "MALHDENVVWHSHPVTVQQRELHHCHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQLVTNLVQQLLDLLRQNDIIRS",
        "proteome": "UP000001030",
        "gene": "cysC",
        "go_terms": [
            {
                "identifier": "GO:0004020",
                "name": "adenylylsulfate kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000103",
                "name": "sulfate assimilation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1c59cf68b0cca9e4b38bd0f18061a8656471c2b7",
        "counters": {
            "domain_architectures": 14683,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14683
        }
    }
}