GET /api/protein/UniProt/B2TU62/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B2TU62",
"id": "B2TU62_SHIB3",
"source_organism": {
"taxId": "344609",
"scientificName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)",
"fullName": "Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)"
},
"name": "Magnesium and cobalt efflux protein CorC",
"description": [
"Plays a role in the transport of magnesium and cobalt ions"
],
"length": 292,
"sequence": "MSDDNSHSSDTISNKKGFFSLLLSQLFHGEPKNRDELLALIRDSGQNDLIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKIPDDSPQPKLDE",
"proteome": "UP000001030",
"gene": "corC",
"go_terms": [
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c02b02a7ceb4a3564b3498665657731810aed8db",
"counters": {
"domain_architectures": 5386,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"profile": 1,
"smart": 2,
"ncbifam": 1,
"panther": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5386
}
}
}