General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2TIG4",
        "id": "RL11_CLOBB",
        "source_organism": {
            "taxId": "935198",
            "scientificName": "Clostridium botulinum (strain Eklund 17B / Type B)",
            "fullName": "Clostridium botulinum (strain Eklund 17B / Type B)"
        },
        "name": "Large ribosomal subunit protein uL11",
        "description": [
            "Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors"
        ],
        "length": 141,
        "sequence": "MAKKVTGMIKLQLQAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFILKTPPAAVLIKKELGLESGSGVPNRTKVGSLTKEQVKKIAETKMPDLNAASIETAMKMIEGTARSMGVTIQE",
        "proteome": null,
        "gene": "rplK",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "24b9caf7b2077b68fd222ea791db02b9beba791e",
        "counters": {
            "domain_architectures": 34921,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 34921
        }
    }
}