General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2SZ58",
        "id": "B2SZ58_PARPJ",
        "source_organism": {
            "taxId": "398527",
            "scientificName": "Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)",
            "fullName": "Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)"
        },
        "name": "Phosphoribosyl-AMP cyclohydrolase",
        "description": [
            "Catalyzes the hydrolysis of the adenine ring of phosphoribosyl-AMP"
        ],
        "length": 136,
        "sequence": "MVNPSAVNWLDKVKWDANGLVPVIAQEASTNDVLMFAWMNREALAKTIETNRAVYFSRSRQRLWFKGEESGHVQHVHEVRLDCDEDVVLLKVEQVSGIACHTGRHSCFFQKFEGSVDDGDWVAVDPVLKDPEHIYK",
        "proteome": null,
        "gene": "hisI",
        "go_terms": [
            {
                "identifier": "GO:0004635",
                "name": "phosphoribosyl-AMP cyclohydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000105",
                "name": "L-histidine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f2a5d9d385d48eff41f7fa0ada0bd18e4e323c4b",
        "counters": {
            "domain_architectures": 13990,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13990
        }
    }
}