GET /api/protein/UniProt/B2RSR2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B2RSR2",
"id": "B2RSR2_MOUSE",
"source_organism": {
"taxId": "10090",
"scientificName": "Mus musculus",
"fullName": "Mus musculus (Mouse)"
},
"name": "Vesicle-trafficking protein SEC22a",
"description": [
"May be involved in vesicle transport between the ER and the Golgi complex"
],
"length": 307,
"sequence": "MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQFPDRCTLKTGRYNINFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDLNYIIAFFLGTAACLYQCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDHDV",
"proteome": null,
"gene": "Sec22a",
"go_terms": [
{
"identifier": "GO:0006888",
"name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c5631a2cd80e0f18677d31170725d8f2bbce23cc",
"counters": {
"domain_architectures": 1691,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"profile": 1,
"smart": 1,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1691
}
}
}