GET /api/protein/UniProt/B2RSR2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2RSR2",
        "id": "B2RSR2_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Vesicle-trafficking protein SEC22a",
        "description": [
            "May be involved in vesicle transport between the ER and the Golgi complex"
        ],
        "length": 307,
        "sequence": "MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQFPDRCTLKTGRYNINFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDLNYIIAFFLGTAACLYQCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDHDV",
        "proteome": null,
        "gene": "Sec22a",
        "go_terms": [
            {
                "identifier": "GO:0006888",
                "name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c5631a2cd80e0f18677d31170725d8f2bbce23cc",
        "counters": {
            "domain_architectures": 1691,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1691
        }
    }
}