GET /api/protein/UniProt/B2K7H2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B2K7H2",
"id": "FDHD_YERPB",
"source_organism": {
"taxId": "502801",
"scientificName": "Yersinia pseudotuberculosis serotype IB (strain PB1/+)",
"fullName": "Yersinia pseudotuberculosis serotype IB (strain PB1/+)"
},
"name": "Sulfur carrier protein FdhD",
"description": [
"Required for formate dehydrogenase (FDH) activity. Acts as a sulfur carrier protein that transfers sulfur from IscS to the molybdenum cofactor prior to its insertion into FDH"
],
"length": 274,
"sequence": "MSQIKPSRLSSSAEIRGARQLDVLQRHKLAEPQQDWLAEEVPVALVYNGISHVVMMATPKDLAAFALGFSLSEGIISSPQDIYAIEMTPGCNGIEVNIELSSRRFAGLKERRRAMAGRTGCGVCGIEQLDDIFRPITPLPFTQAFNLEHLDTALAQLKQVQPVGQLTGCTHAAAWINPEGELLGGCEDVGRHVALDKLLGIRAKQPWQQGAVLVSSRASYEMVQKTAMCGAEILFAVSAATTLAVEVAERCNLTLVGFSKPGRATVYTHPQRIK",
"proteome": null,
"gene": "fdhD",
"go_terms": [
{
"identifier": "GO:0016783",
"name": "sulfurtransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3a9dbe1d8d6f53c0d92f0d4dfaa220a876b7bed9",
"counters": {
"domain_architectures": 17625,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17625
}
}
}