GET /api/protein/UniProt/B2K2I2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2K2I2",
        "id": "PLSY_YERPB",
        "source_organism": {
            "taxId": "502801",
            "scientificName": "Yersinia pseudotuberculosis serotype IB (strain PB1/+)",
            "fullName": "Yersinia pseudotuberculosis serotype IB (strain PB1/+)"
        },
        "name": "Glycerol-3-phosphate acyltransferase",
        "description": [
            "Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP"
        ],
        "length": 216,
        "sequence": "MSAIALGMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGATNVLRIGGRTAAVAVLLFDILKGMLPVWIAYLLHIPPLYLGLTAIAACLGHIYPVFFHFKGGKGVATAFGAIAPIGWDLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIWDKLRKKKQKTPAEEAAELEEKED",
        "proteome": null,
        "gene": "plsY",
        "go_terms": [
            {
                "identifier": "GO:0043772",
                "name": "acyl-phosphate glycerol-3-phosphate acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008654",
                "name": "phospholipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7dfe14e5027783d2cdf9d0df7217f72b1f646d6d",
        "counters": {
            "domain_architectures": 19421,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19421
        }
    }
}