General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2J9J6",
        "id": "B2J9J6_NOSP7",
        "source_organism": {
            "taxId": "63737",
            "scientificName": "Nostoc punctiforme (strain ATCC 29133 / PCC 73102)",
            "fullName": "Nostoc punctiforme (strain ATCC 29133 / PCC 73102)"
        },
        "name": "Threonine synthase",
        "description": [
            "Catalyzes the gamma-elimination of phosphate from L-phosphohomoserine and the beta-addition of water to produce L-threonine"
        ],
        "length": 363,
        "sequence": "MTLSLSVAKSHRQPWPGLIEAYRQYLPVSEKTPVVTLLEGNTPLIPVPAIAERIGRQVRVFVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMNAFVLIPDGYVALGKLAQALLYGAEVLAIKGNFDQALEIVREMAESYPVTLVNSVNPYRLEGQKTGAFEIVDALGDAPDWLCIPVGNAGNITAYWMGFCQYHQDGKCDRLPRMMGFQAAGAAPLVHGQPVAHPETLATAIRIGNPASWELAIAAQTASQGNFHAVTDAEILDAYRLLASSEGIFCEPASAASVAGLLQVKDQIPTGATVVCVLTGNGLKDPDTAIKHNHSQFKQGIAAELGAVAEAMGF",
        "proteome": "UP000001191",
        "gene": "Npun_F0743",
        "go_terms": [
            {
                "identifier": "GO:0004795",
                "name": "threonine synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009088",
                "name": "L-threonine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006520",
                "name": "amino acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8bc361cd7c1d6142f8798dedc919bc5496ed8194",
        "counters": {
            "domain_architectures": 181949,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 181949
        }
    }
}