GET /api/protein/UniProt/B2GNS7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2GNS7",
        "id": "B2GNS7_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "U5 small nuclear ribonucleoprotein TSSC4",
        "description": [
            "Protein associated with the U5 snRNP, during its maturation and its post-splicing recycling and which is required for spliceosomal tri-snRNP complex assembly in the nucleus. Has a molecular sequestering activity and transiently hinders SNRNP200 binding sites for constitutive splicing factors that intervene later during the assembly of the spliceosome and splicing. Together with its molecular sequestering activity, may also function as a molecular adapter and placeholder, coordinating the assembly of the U5 snRNP and its association with the U4/U6 di-snRNP"
        ],
        "length": 306,
        "sequence": "MSDRKRKGNDAPNSLSNRDTVELPDDLSLSDSDSDEPLESFGRKIEDLSSSSEEEGETRQQVQSVLQENPSFRLTGGSSSFCDRSRDIFAQLDSAAKLTSKDLGEDNILDGTLARPAPPSPPHAVQNKCGVGQELTKKQPPGKKLPDYLAHPERWTHYSLEDIDETSDKKNSQVAHEYIRELQDSKRSQKAALETFTPAFNQDHGSSNENKIVFAKPKSKDQSGSRADHAKKEEVGLQHLDDRVEADEGEALQQSSSWPNKEKKRKWGVTKEEDDTVAPSAVFTSSKRVNRKNFRKTPDDNDGDKE",
        "proteome": null,
        "gene": "tssc4",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b39f799bf076b12df70bb7d627766c96a5d8efcc",
        "counters": {
            "domain_architectures": 1757,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1757
        }
    }
}