HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B1YJ39",
"id": "DAPA_EXIS2",
"source_organism": {
"taxId": "262543",
"scientificName": "Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)",
"fullName": "Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)"
},
"name": "4-hydroxy-tetrahydrodipicolinate synthase",
"description": [
"Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA)"
],
"length": 293,
"sequence": "MFKGAGTALATPFTSTGELDLAVFEQLIEQQLAANIQALVVGGTTGEGSTLTNEEFETLLETAIRVTAGRVPVIAGTGTNNTAQTIEKTQTAARLGADAAMLVTPYYNKTSQAGLVAHFTAVADAVDLPIMLYNVPSRTGVAISVETAVTLAKHPNIQAFKEASGDVSFMGELMTALPDGFAVFCGNDDQILPYMAWGAQGVISVLSNPYPAETQALAEALLANDYTTARRIQSDLMPVISALFSDVNPIPVKAALEEIGLAVGAPRLPLVRQSEAGHAHLLETMRSYKGVVG",
"proteome": "UP000001681",
"gene": "dapA",
"go_terms": [
{
"identifier": "GO:0016829",
"name": "lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008840",
"name": "4-hydroxy-tetrahydrodipicolinate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009089",
"name": "L-lysine biosynthetic process via diaminopimelate",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "750b5f971a62440c98af9df6232c38f92b6dc765",
"counters": {
"domain_architectures": 84471,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 2,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 84471
}
}
}