General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B1YA33",
        "id": "RL2_PYRNV",
        "source_organism": {
            "taxId": "444157",
            "scientificName": "Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)",
            "fullName": "Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)"
        },
        "name": "Large ribosomal subunit protein uL2",
        "description": [
            "One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome"
        ],
        "length": 245,
        "sequence": "MGKRILVQRRGRGGSQFRSPSWRREGPVRYPPLGTAGRGYVVDIIHVPGLNAPVAKIRLENGLEFLNYAAEGLYVGQEIEIGEAASPKTGNVVVLGKAPEGTMVFNVEKRPGDGGKFARSGGTYAVVVGQKPEENKTIVRLPSGRTMEVDARGRATVGLVAGGGRIEKPMVKAGKKYYRARAKAWKYPLVRGKAMSPYAHPHGGGSHQKGGTPVSKTAPPGQKVGFIGSRCTGRGCVRARAQQKQ",
        "proteome": "UP000001694",
        "gene": "rpl2",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015934",
                "name": "large ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5772a17010a70330e221d83d6ea0ef09e6bd58ed",
        "counters": {
            "domain_architectures": 3578,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "smart": 2,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3578
        }
    }
}