GET /api/protein/UniProt/B1Y4W6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B1Y4W6",
        "id": "AROE_LEPCP",
        "source_organism": {
            "taxId": "395495",
            "scientificName": "Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)",
            "fullName": "Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)"
        },
        "name": "Shikimate dehydrogenase (NADP(+))",
        "description": [
            "Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA)"
        ],
        "length": 277,
        "sequence": "MDRYAVAGYPVKHSRSPAIHSQFAAQTGEPLVYEKLEVLPGTFVASVQAFQAAGGRGCNVTVPYKLEAFEAAARRTPRAEMAQAINTLRFDADGWTGDNTDGAGLVRDIEVNGGVSLRGRRVLLIGAGGAASGALAPLIEAGPAELVMCNRTVARAQQSVQRHAELARARGVALSAATLDDCGSGFDVIINATSSSLAGMPSPVGAQVLRPGSLVLDMMYGPAAKPFLAWAQSHGATARDGLGMLIEQAAEAFFFWRGVRPATDGVMAGIRAELDAA",
        "proteome": "UP000001693",
        "gene": "aroE",
        "go_terms": [
            {
                "identifier": "GO:0004764",
                "name": "shikimate 3-dehydrogenase (NADP+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019632",
                "name": "shikimate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "27f73ccca551f481719533ba9853869fec77f542",
        "counters": {
            "domain_architectures": 13771,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 3,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13771
        }
    }
}