HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B1JVP0",
"id": "NUOB_BURO0",
"source_organism": {
"taxId": "406425",
"scientificName": "Burkholderia orbicola (strain MC0-3)",
"fullName": "Burkholderia orbicola (strain MC0-3)"
},
"name": "NADH-quinone oxidoreductase subunit B",
"description": [
"NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity)"
],
"length": 159,
"sequence": "MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTNTIARQ",
"proteome": null,
"gene": "nuoB",
"go_terms": [
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0048038",
"name": "quinone binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ec2bdf213efa2e994a9300f4d128e854c4d858c2",
"counters": {
"domain_architectures": 44517,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 44517
}
}
}