HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B1JUL2",
"id": "B1JUL2_BURO0",
"source_organism": {
"taxId": "406425",
"scientificName": "Burkholderia orbicola (strain MC0-3)",
"fullName": "Burkholderia orbicola (strain MC0-3)"
},
"name": "UDP-2,3-diacylglucosamine hydrolase",
"description": [
"Hydrolyzes the pyrophosphate bond of UDP-2,3-diacylglucosamine to yield 2,3-diacylglucosamine 1-phosphate (lipid X) and UMP by catalyzing the attack of water at the alpha-P atom. Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
],
"length": 266,
"sequence": "MLQESPPRSVSAGVPGEREYAQAARPFLFLSDLHLSGAIPKTVAAFEHFVKYTADSADSVFILGDLFEYWIGDDILDDDPFAARMAALMHTFSERGIALYVMHGNRDFLLGRRFMKAAGAMLLPDPSLIMAFGQRIVLAHGDAQCTADRGYQVFRRFARNRVAQWLFLAWPFRWRRALAQRMRSNSEAGRMRPASAIYDVTRDGVAALFRKSRASVIIHGHTHRPARHAEPGGIRWVLPDWDLDHGTPRGGYLRVDAEGIHAMPLD",
"proteome": null,
"gene": "lpxH",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016462",
"name": "pyrophosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009245",
"name": "lipid A biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e949b0a1fe9e51299d6615c55240932f5c7152f8",
"counters": {
"domain_architectures": 234891,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 234891
}
}
}