GET /api/protein/UniProt/B1IJE3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B1IJE3",
"id": "B1IJE3_CLOBK",
"source_organism": {
"taxId": "498213",
"scientificName": "Clostridium botulinum (strain Okra / Type B1)",
"fullName": "Clostridium botulinum (strain Okra / Type B1)"
},
"name": "Glycine/sarcosine/betaine reductase complex component A1 (Selenoprotein PA 1) (Thioredoxinreductase complex A 1)",
"description": [
"In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination"
],
"length": 43,
"sequence": "MSLFEGKKVIIIGDRDGIPGPAIEKCIEGTGAEVVFSSTECFV",
"proteome": null,
"gene": "CLD_3306",
"go_terms": [
{
"identifier": "GO:0030699",
"name": "glycine reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050485",
"name": "oxidoreductase activity, acting on X-H and Y-H to form an X-Y bond, with a disulfide as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030700",
"name": "glycine reductase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0198146b7e4bf22a74132a73d33a4ad832e1f339",
"counters": {
"domain_architectures": 1058,
"entries": 2,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1058
}
}
}