GET /api/protein/UniProt/B1H1X1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B1H1X1",
        "id": "FXL17_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "F-box/LRR-repeat protein 17",
        "description": [
            "Substrate-recognition component of the SCF(FBXL17) E3 ubiquitin ligase complex, a key component of a quality control pathway required to ensure functional dimerization of BTB domain-containing proteins (dimerization quality control, DQC) (PubMed:30190310). FBXL17 specifically recognizes and binds a conserved degron of non-consecutive residues present at the interface of BTB dimers of aberrant composition: aberrant BTB dimer are then ubiquitinated by the SCF(FBXL17) complex and degraded by the proteasome (By similarity). The ability of the SCF(FBXL17) complex to eliminate compromised BTB dimers is required for the differentiation and survival of neural crest and neuronal cells (PubMed:30190310)"
        ],
        "length": 673,
        "sequence": "MGHVAPHASKKEHVAPHAAEKDHVAPHASKKEHVAPHAAEKGQVAPYAAGEGQVAPNAAGERPVAPYAAGEGQVAPYAAGEGQVAPYAAGEGQVAPYAAGEGQVAPYAAGEAQVAPHAAGEGRVAPHAAGDGQVEHCTVEDREEGHIGTTEQGHMSHYTSKLEHMAPPSAQTEAVVSYVAGERHAPPDCTVSGPAMCCSAEARQTTPDWTTTGPEISQGTLPGLTVLHVGGTWQTFAAEDEPCVTTLLSPVKPLSSSRKYAPYNLQIPSYSESEPQAHKGLSSETFGPCEPLHINQLPSSLLLKIFSNLSLNERCILASLVCKYWRDLCLDSQFWKQLDLSNRQQIKDNILEEIASRSQNITEINISDCFSVSDQGVCVVALKCPGLVKYTAYRCKQLSDISLIALAAHCPSLQKVHVGNQDKLSDEALIQMGRRCKELKDIHFGQCYKISDEGLIVIAKGCQKLQKIYMQENKLVSDESVKAFAEHCPGLQYVGFMGCSVTSEGVINLTKLKHLSSLDLRHITELDNETVMEIVKQCQHLTSLNLCLNRSINDRCVEVIAKEGRSLKELYLVTCKITDYALIAIGRYSKSIETVDVGWCKEITDYGAKQIAQSSKSIRYLGLMRCDKVNEATVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNASPAT",
        "proteome": "UP000186698",
        "gene": "fbxl17",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "11782c3bc8f670c683e21a80b0a1022d22a95e1b",
        "counters": {
            "domain_architectures": 6078,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "smart": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6078
        }
    }
}